PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g31276.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HB-other
Protein Properties Length: 169aa    MW: 18758.5 Da    PI: 10.1001
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g31276.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox505.2e-16611031456
                       HHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  14 eLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +L +lF++++++++++ +eL+++l+L+ rqVk+WFqNrR+++k
  Bradi2g31276.1.p  61 ALCRLFKECPHLDEKQHAELSRRLSLDARQVKFWFQNRRTQMK 103
                       7889************************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003896.7E-647109IPR001356Homeobox domain
SuperFamilySSF466892.35E-1356105IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.1E-1561112IPR009057Homeodomain-like
PfamPF000461.9E-1361103IPR001356Homeobox domain
PROSITE profilePS5007113.02162105IPR001356Homeobox domain
CDDcd000861.20E-964105No hitNo description
PROSITE patternPS00027080103IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MTAGRGATTW TPSPASETTT TPSPATPASG RSVKAPLIAR ARILLSLRLF SLVISCMDSS  60
ALCRLFKECP HLDEKQHAEL SRRLSLDARQ VKFWFQNRRT QMKTQLERHE NTLLKQENDK  120
LCGSTYALRT HGSRMNSTES VPLPPSSLAN LYPSCHRSSC SHTCQCRL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF8574848e-67KF857484.1 Avena strigosa cultivar S75 homeobox-leucine zipper protein (HDZ1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0Q3MRK18e-59A0A0Q3MRK1_BRADI; Uncharacterized protein
STRINGBRADI3G23370.19e-39(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.15e-28HD-ZIP family protein